PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P09690_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 439aa    MW: 48956.6 Da    PI: 7.7816
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P09690_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2608.5e-80674361374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lLl +A a++++++ +a  +L  l ++as +g pmqR+ ayf+ +Laar++  +s  y+++ + +t+    +ee++ ++ ++ +
  GSMUA_Achr10P09690_001  67 LRRLLLLAASAIDADHADAAIDALVDLYQHASLHGHPMQRVMAYFADGLAARILTDSSPFYRSIMAHPTP----EEEFTGFTELYRA 149
                             6899************************************************************999998....56667778899** PP

                    GRAS  88 sPilkfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLak 167
                             sP+++f+h+taNq+I+ea+e e     +r+ +iDfd+s+G+QWp+L+q+L +++  ++p sl +Tg+g+    s+eel++t+ rL  
  GSMUA_Achr10P09690_001 150 SPCYQFAHFTANQTIVEAFEAEekqngRRLYVIDFDVSYGFQWPSLIQSLCDKAttSKPISLHLTGFGR----STEELKNTETRLVG 232
                             ********************9988888899*********************999866667*********....9************* PP

                    GRAS 168 fAeel.gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                             f +++ +++f +n l    l   ++++L+++++ +laVnlv+ l+++ ++s  l     ++L  + sl+P vvv++e+e++   + +
  GSMUA_Achr10P09690_001 233 FSKSCsNLEFVYNGL----LRGSTTSDLKIEKNATLAVNLVFYLQTMKSSSEML-----ATLMSIHSLNPSVVVLAEKEISQRPAGY 310
                             ***9758*******8....7778899*********************8444444.....46************************** PP

                    GRAS 254 lerfle.aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                              +rf+e +l+y++a+f sl+  lp++s  r ++E+  lgrei+++++c+ ++        + W+ r+e+ GF+ ++ls++ ++qakl
  GSMUA_Achr10P09690_001 311 SARFVEsSLNYFAAMFRSLHDCLPADSLGRLSIEKNHLGREIKSAITCNCEK-------TSAWKGRMESTGFQGMKLSSRSVSQAKL 390
                             *****846****************************************8665.......899************************* PP

                    GRAS 340 llr.........kvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                             ll+         +v++ g+ + e     +l l+ +dr+L++vSaW+
  GSMUA_Achr10P09690_001 391 LLKikgqfstieHVSNSGFGISETddGRTLSLCLQDRNLITVSAWK 436
                             *982222222212334556665443255666**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.16441405IPR005202Transcription factor GRAS
PfamPF035143.0E-7767436IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MEGDDNVRAW RSHAIKKRKA RDGFGACHVK AKDADDGKFL VLLQAKERML REDPKRSGQE  60
DATDEQLRRL LLLAASAIDA DHADAAIDAL VDLYQHASLH GHPMQRVMAY FADGLAARIL  120
TDSSPFYRSI MAHPTPEEEF TGFTELYRAS PCYQFAHFTA NQTIVEAFEA EEKQNGRRLY  180
VIDFDVSYGF QWPSLIQSLC DKATTSKPIS LHLTGFGRST EELKNTETRL VGFSKSCSNL  240
EFVYNGLLRG STTSDLKIEK NATLAVNLVF YLQTMKSSSE MLATLMSIHS LNPSVVVLAE  300
KEISQRPAGY SARFVESSLN YFAAMFRSLH DCLPADSLGR LSIEKNHLGR EIKSAITCNC  360
EKTSAWKGRM ESTGFQGMKL SSRSVSQAKL LLKIKGQFST IEHVSNSGFG ISETDDGRTL  420
SLCLQDRNLI TVSAWKCTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-36724368375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420571.10.0PREDICTED: scarecrow-like protein 23
TrEMBLM0RGU50.0M0RGU5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P09690_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116493038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-40GRAS family protein